PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 226aa    MW: 25886.3 Da    PI: 7.0189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42912.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-17550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd ll+++++q+G g W++++   g++R++k+c++rw++yl
       KHN42912.1  5 AWTEEEDHLLKKCIQQYGEGKWHRVPLLAGLNRCRKSCRLRWLNYL 50
                     7*******************************************97 PP

2Myb_DNA-binding49.11.3e-1556100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ +eE e +++++k+lG++ W++Ia +++ gRt++++k++w+ +
       KHN42912.1  56 RGNFAEEEVEMIIKLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNCH 100
                      8999******************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.777150IPR017930Myb domain
SMARTSM007175.8E-13252IPR001005SANT/Myb domain
PfamPF002491.1E-15550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-21557IPR009057Homeodomain-like
SuperFamilySSF466898.07E-28597IPR009057Homeodomain-like
CDDcd001671.22E-10550No hitNo description
PROSITE profilePS5129425.11651105IPR017930Myb domain
SMARTSM007172.8E-1555103IPR001005SANT/Myb domain
PfamPF002492.0E-135698IPR001005SANT/Myb domain
CDDcd001675.64E-1158101No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2458105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGGVAWTEEE DHLLKKCIQQ YGEGKWHRVP LLAGLNRCRK SCRLRWLNYL RPNIKRGNFA  60
EEEVEMIIKL HKLLGNRWSL IAGRLPGRTA NDVKNYWNCH LSKKLNVIEA EDRPITRDVQ  120
VIRPQPRNIV GSSSVKRRGQ NESPTDKGVQ QESSMSSLTF DTADGQNHML DSQQDNNIYA  180
CLDQQGIVSE LSMDFQFEGF GAMMNGEGSS SQWDWGDLLL DMDLYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22610710110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602623.11e-170PREDICTED: transcription factor MYB90-like
SwissprotQ9FNV92e-56MY113_ARATH; Transcription factor MYB113
TrEMBLA0A0B2SF141e-170A0A0B2SF14_GLYSO; Transcription factor MYB113
TrEMBLI1N2Q11e-170I1N2Q1_SOYBN; Uncharacterized protein
STRINGGLYMA18G41520.11e-169(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.15e-58myb domain protein 113
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]